PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.D00064.1.p
Common NameLOC105955215, MIMGU_mgv1a010400mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 314aa    MW: 34488.9 Da    PI: 4.7966
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.D00064.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY110.48e-35165222259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYY+Ct+a+C+vkk+vers++dp++v++tYeg+H+h+
  Migut.D00064.1.p 165 EDGYRWRKYGQKAVKNSPFPRSYYKCTFASCNVKKRVERSSDDPSIVVTTYEGQHTHP 222
                       8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.1E-951312IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.1E-35149224IPR003657WRKY domain
SuperFamilySSF1182907.19E-30156224IPR003657WRKY domain
PROSITE profilePS5081131.64159224IPR003657WRKY domain
SMARTSM007742.3E-41164223IPR003657WRKY domain
PfamPF031061.7E-27165222IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEDPCPSSSD HYYPVMSNFS LAELLEYSEE AEKSCSSLGF MELLNMQQDF GGGGGGAPPS  60
SVFDVLQQPN CVEPSNNNQI QDSSDHVLNA PPTPNYSSIS SESSGGGGQN DEHTKEGVEE  120
EEDEEELEEN HKTKKQLKAK KTTSQKKQRE PRFAFMTKSE VDHLEDGYRW RKYGQKAVKN  180
SPFPRSYYKC TFASCNVKKR VERSSDDPSI VVTTYEGQHT HPSPINSRSS AAAAALPPPY  240
NSGFSIGGAA RFQPPAQMVS AQNNNQQQFM SFLANCGGAQ QLLFGPQSSA NLLADHGLLQ  300
DILPWSFIKN EEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-261572241077Probable WRKY transcription factor 4
1wj2_A2e-261572241077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834377.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229009e-61WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLA0A022S2300.0A0A022S230_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000233689e-68(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.14e-45WRKY DNA-binding protein 23